FAAH2 Antikörper (C-Term)

Produktnummer ABIN636114

Dieser Anti-FAAH2-Antikörper ist ein Kaninchen-Polyklonal-Antikörper zum Nachweis von FAAH2 in WB. Geeignet für Human.

Kurzübersicht für FAAH2 Antikörper (C-Term) (ABIN636114)

Target: FAAH2 (Fatty Acid Amide Hydrolase 2 (FAAH2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAAH2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FAAH2 Antikörper

Bindungsspezifität: C-Term

Spezifität: FAAH2 antibody was raised against the C terminal of FAAH2

Aufreinigung: Affinity purified

Immunogen: FAAH2 antibody was raised using the C terminal of FAAH2 corresponding to a region with amino acids SPLWELIKWCLGLSVYTIPSIGLALLEEKLRYSNEKYQKFKAVEESLRKE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAAH2 Blocking Peptide, (ABIN5613444), is also available for use as a blocking control in assays to test for specificity of this FAAH2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAAH2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAAH2

Target: FAAH2 (Fatty Acid Amide Hydrolase 2 (FAAH2))

Andere Bezeichnung: FAAH2

Hintergrund: Fatty acid amide hydrolases, such as FAAH1 and FAAH2, hydrolyze primary fatty acid amide substrates and may play a role in fatty acid catabolism.

Molekulargewicht: 58 kDa (MW of target protein)