FAAH2 Antikörper (C-Term)
-
- Target Alle FAAH2 Antikörper anzeigen
- FAAH2 (Fatty Acid Amide Hydrolase 2 (FAAH2))
-
Bindungsspezifität
- C-Term
- Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FAAH2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FAAH2 antibody was raised against the C terminal of FAAH2
- Aufreinigung
- Affinity purified
- Immunogen
- FAAH2 antibody was raised using the C terminal of FAAH2 corresponding to a region with amino acids SPLWELIKWCLGLSVYTIPSIGLALLEEKLRYSNEKYQKFKAVEESLRKE
- Top Product
- Discover our top product FAAH2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FAAH2 Blocking Peptide, catalog no. 33R-8683, is also available for use as a blocking control in assays to test for specificity of this FAAH2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAAH2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAAH2 (Fatty Acid Amide Hydrolase 2 (FAAH2))
- Andere Bezeichnung
- FAAH2 (FAAH2 Produkte)
- Hintergrund
- Fatty acid amide hydrolases, such as FAAH1 and FAAH2, hydrolyze primary fatty acid amide substrates and may play a role in fatty acid catabolism.
- Molekulargewicht
- 58 kDa (MW of target protein)
-