SLC19A3 Antikörper (Middle Region)

Produktnummer ABIN636108

Der Kaninchen Polyklonal anti-SLC19A3 Antikörper (ABIN636108) detektiert spezifisch SLC19A3 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human und Maus.

Kurzübersicht für SLC19A3 Antikörper (Middle Region) (ABIN636108)

Target: SLC19A3 (Slc19a3) (Solute Carrier Family 19, Member 3 (Slc19a3))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC19A3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC19A3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SLC19 A3 antibody was raised against the middle region of SLC19 3

Aufreinigung: Affinity purified

Immunogen: SLC19 A3 antibody was raised using the middle region of SLC19 3 corresponding to a region with amino acids FATAGFNQVLNYVQILWDYKAPSQDSSIYNGAVEAIATFGGAVAAFAVGY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC19A3 Blocking Peptide, (ABIN938234), is also available for use as a blocking control in assays to test for specificity of this SLC19A3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC19A3

Target: SLC19A3 (Slc19a3) (Solute Carrier Family 19, Member 3 (Slc19a3))

Andere Bezeichnung: SLC19A3

Hintergrund: SLC19A3 mediates high affinity thiamine uptake, propably via a proton anti-port mechanism. SLC19A3 has no folate transport activity.SLC19A3 is a member of the reduced folate family of micronutrient transporter genes.

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport