SLC20A2 Antikörper

Produktnummer ABIN636107

Produktdetails anti-SLC20A2 Antikörper

Target: SLC20A2 (Solute Carrier Family 20 (Phosphate Transporter), Member 2 (SLC20A2))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC20A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLC20 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC20A2 Blocking Peptide, catalog no. 33R-2221, is also available for use as a blocking control in assays to test for specificity of this SLC20A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC20A2

Target: SLC20A2 (Solute Carrier Family 20 (Phosphate Transporter), Member 2 (SLC20A2))

Andere Bezeichnung: SLC20A2 (SLC20A2 Produkte)

Synonyme: wu:fi23g11 antikoerper, zgc:152990 antikoerper, glvr-2 antikoerper, glvr2 antikoerper, mlvar antikoerper, pit-2 antikoerper, pit2 antikoerper, SLC20A2 antikoerper, GLVR-2 antikoerper, GLVR2 antikoerper, IBGC3 antikoerper, MLVAR antikoerper, PIT-2 antikoerper, PIT2 antikoerper, RAM1 antikoerper, Ab1-188 antikoerper, Glvr2 antikoerper, Pit-2 antikoerper, RAM-1 antikoerper, Ram1 antikoerper, MolPit2 antikoerper, Pit2 antikoerper, Ram-1 antikoerper, ChoPit2 antikoerper, HaPit2 antikoerper, PiT-2 antikoerper, solute carrier family 20 member 2 antikoerper, solute carrier family 20 (phosphate transporter), member 2 antikoerper, solute carrier family 20 (phosphate transporter), member 2 L homeolog antikoerper, solute carrier family 20, member 2 antikoerper, SLC20A2 antikoerper, slc20a2 antikoerper, slc20a2.L antikoerper, Slc20a2 antikoerper

Hintergrund: SLC20A2 is a sodium-phosphate symporter which seems to play a fundamental housekeeping role in phosphate transport by absorbing phosphate from interstitial fluid for normal cellular functions such as cellular metabolism, signal transduction, and nucleic acid and lipid synthesis. In vitro, sodium-dependent phosphate uptake is not siginificantly affected by acidic and alkaline conditions, however sodium-independent phosphate uptake occurs at acidic conditions. It may play a role in extracellular matrix, cartilage and vascular calcification.

Molekulargewicht: 70 kDa (MW of target protein)