CTRB1 Antikörper (N-Term)

Produktnummer ABIN636104

Der Kaninchen Polyklonal Anti-CTRB1-Antikörper wurde für WB validiert. Er ist geeignet, CTRB1 in Proben von Human zu detektieren.

Kurzübersicht für CTRB1 Antikörper (N-Term) (ABIN636104)

Target: CTRB1 (Chymotrypsinogen B1 (CTRB1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CTRB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CTRB1 Antikörper

Bindungsspezifität: N-Term

Spezifität: Chymotrypsinogen B1 antibody was raised against the N terminal of CTRB1

Aufreinigung: Affinity purified

Immunogen: Chymotrypsinogen B1 antibody was raised using the N terminal of CTRB1 corresponding to a region with amino acids MASLWLLSCFSLVGAAFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Chymotrypsinogen B1 Blocking Peptide, (ABIN5612885), is also available for use as a blocking control in assays to test for specificity of this Chymotrypsinogen B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTRB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CTRB1

Target: CTRB1 (Chymotrypsinogen B1 (CTRB1))

Andere Bezeichnung: Chymotrypsinogen B1

Hintergrund: Alpha-chymotrypsin is one of a family of serine proteases secreted into the gastrointestinal tract as the inactive precursor chymotrypsinogen. The zymogen is activated by proteolytic cleavage by trypsin.

Molekulargewicht: 28 kDa (MW of target protein)