STS Antikörper

Produktnummer ABIN636085

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch STS in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für STS Antikörper (ABIN636085)

Target: STS (Steroid Sulfatase (Microsomal), Isozyme S (STS))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser STS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-STS Antikörper

Aufreinigung: Affinity purified

Immunogen: STS antibody was raised using a synthetic peptide corresponding to a region with amino acids EPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQRSDHEFLFHY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

STS Blocking Peptide, (ABIN938038), is also available for use as a blocking control in assays to test for specificity of this STS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu STS

Target: STS (Steroid Sulfatase (Microsomal), Isozyme S (STS))

Andere Bezeichnung: STS

Hintergrund: STS catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in its gene are known to cause X-linked ichthyosis.

Molekulargewicht: 63 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis