MAGT1 Antikörper (N-Term)

Produktnummer ABIN636081

Dieses Anti-MAGT1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von MAGT1 in WB. Geeignet für Human.

Kurzübersicht für MAGT1 Antikörper (N-Term) (ABIN636081)

Target: MAGT1 (Magnesium Transporter 1 (MAGT1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAGT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MAGT1 Antikörper

Bindungsspezifität: N-Term

Spezifität: RP11-217 H1.1 antibody was raised against the N terminal Of Rp11-217 1.1

Aufreinigung: Affinity purified

Immunogen: RP11-217 H1.1 antibody was raised using the N terminal Of Rp11-217 1.1 corresponding to a region with amino acids ARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEKVSQLMEWTNKRP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RP.1 Blocking Peptide, (ABIN936886), is also available for use as a blocking control in assays to test for specificity of this RP.1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RP11-210 1.1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAGT1

Target: MAGT1 (Magnesium Transporter 1 (MAGT1))

Andere Bezeichnung: RP11-217H1.1

Hintergrund: The function of RP11-217H1.1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 41 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis