CYP20A1 Antikörper (N-Term)

Produktnummer ABIN636079

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch CYP20A1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für CYP20A1 Antikörper (N-Term) (ABIN636079)

Target: CYP20A1 (Cytochrome P450, Family 20, Subfamily A, Polypeptide 1 (CYP20A1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYP20A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CYP20A1 Antikörper

Bindungsspezifität: N-Term

Spezifität: CYP20 A1 antibody was raised against the N terminal of CYP20 1

Aufreinigung: Affinity purified

Immunogen: CYP20 A1 antibody was raised using the N terminal of CYP20 1 corresponding to a region with amino acids ITPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CYP20A1 Blocking Peptide, (ABIN939571), is also available for use as a blocking control in assays to test for specificity of this CYP20A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP20 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CYP20A1

Target: CYP20A1 (Cytochrome P450, Family 20, Subfamily A, Polypeptide 1 (CYP20A1))

Andere Bezeichnung: CYP20A1

Hintergrund: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

Molekulargewicht: 52 kDa (MW of target protein)