CYP4F3 Antikörper (N-Term)

Produktnummer ABIN636077

Der Kaninchen Polyklonal Anti-CYP4F3-Antikörper wurde für WB validiert. Er ist geeignet, CYP4F3 in Proben von Human zu detektieren.

Kurzübersicht für CYP4F3 Antikörper (N-Term) (ABIN636077)

Target: CYP4F3 (Cytochrome P450, Family 4, Subfamily F, Polypeptide 3 (CYP4F3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYP4F3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CYP4F3 Antikörper

Bindungsspezifität: N-Term

Spezifität: CYP4 F3 antibody was raised against the N terminal of CYP4 3

Aufreinigung: Affinity purified

Immunogen: CYP4 F3 antibody was raised using the N terminal of CYP4 3 corresponding to a region with amino acids LAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLLYTQSLACTF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CYP4F3 Blocking Peptide, (ABIN940198), is also available for use as a blocking control in assays to test for specificity of this CYP4F3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CYP4F3

Target: CYP4F3 (Cytochrome P450, Family 4, Subfamily F, Polypeptide 3 (CYP4F3))

Andere Bezeichnung: CYP4F3

Hintergrund: This gene, CYP4F3, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

Molekulargewicht: 60 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis, C21-Steroid Hormone Metabolic Process, Monocarboxylic Acid Catabolic Process