RHCE Antikörper (N-Term)

Produktnummer ABIN636066

Dieses Anti-RHCE-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von RHCE in WB. Geeignet für Human.

Kurzübersicht für RHCE Antikörper (N-Term) (ABIN636066)

Target: RHCE (Rhesus Blood Group, CcEe Antigens (RHCE))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RHCE Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RHCE Antikörper

Bindungsspezifität: N-Term

Spezifität: RHCE antibody was raised against the N terminal of RHCE

Aufreinigung: Affinity purified

Immunogen: RHCE antibody was raised using the N terminal of RHCE corresponding to a region with amino acids SSKYPRSVRRCLPLCALTLEAALILLFYFFTHYDASLEDQKGLVASYQVG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RHCE Blocking Peptide, (ABIN5615855), is also available for use as a blocking control in assays to test for specificity of this RHCE antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHCE antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RHCE

Target: RHCE (Rhesus Blood Group, CcEe Antigens (RHCE))

Andere Bezeichnung: RHCE

Hintergrund: The Rh blood group system is the second most clinically significant of the blood groups, second only to ABO. It is also the most polymorphic of the blood groups, with variations due to deletions, gene conversions, and missense mutations. The Rh blood group includes this gene which encodes both the RhC and RhE antigens on a single polypeptide and a second gene which encodes the RhD protein. The classification of Rh-positive and Rh-negative individuals is determined by the presence or absence of the highly immunogenic RhD protein on the surface of erythrocytes. A mutation in this gene results in amorph-type Rh-null disease.

Molekulargewicht: 29 kDa (MW of target protein)