EPHX4 Antikörper (N-Term)

Produktnummer ABIN636062

Der Kaninchen Polyklonal Anti-EPHX4-Antikörper wurde für WB validiert. Er ist geeignet, EPHX4 in Proben von Human und Maus zu detektieren.

Kurzübersicht für EPHX4 Antikörper (N-Term) (ABIN636062)

Target: EPHX4 (Epoxide Hydrolase 4 (EPHX4))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EPHX4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EPHX4 Antikörper

Bindungsspezifität: N-Term

Spezifität: ABHD7 antibody was raised against the N terminal of ABHD7

Aufreinigung: Affinity purified

Immunogen: ABHD7 antibody was raised using the N terminal of ABHD7 corresponding to a region with amino acids HCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKSEY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ABHD7 Blocking Peptide, (ABIN939091), is also available for use as a blocking control in assays to test for specificity of this ABHD7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABHD7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EPHX4

Target: EPHX4 (Epoxide Hydrolase 4 (EPHX4))

Andere Bezeichnung: ABHD7

Hintergrund: The specific function of ABHD7 is not yet known.

Molekulargewicht: 42 kDa (MW of target protein)