DAGLB Antikörper (Middle Region)

Produktnummer ABIN636059

Produktdetails anti-DAGLB Antikörper

Target: DAGLB (Diacylglycerol Lipase, beta (DAGLB))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DAGLB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DAGLB antibody was raised against the middle region of DAGLB

Aufreinigung: Affinity purified

Immunogen: DAGLB antibody was raised using the middle region of DAGLB corresponding to a region with amino acids STAELFSTYFSDTDLVPSDIAAGLALLHQQQDNIRNNQEPAQVVCHAPGS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DAGLB Blocking Peptide, catalog no. 33R-8863, is also available for use as a blocking control in assays to test for specificity of this DAGLB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAGLB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DAGLB

Target: DAGLB (Diacylglycerol Lipase, beta (DAGLB))

Andere Bezeichnung: DAGLB (DAGLB Produkte)

Synonyme: DAGLBETA antikoerper, KCCR13L antikoerper, E330036I19Rik antikoerper, RGD1310193 antikoerper, sn1-specific diacylglycerol lipase beta antikoerper, diacylglycerol lipase, beta antikoerper, diacylglycerol lipase beta antikoerper, LOC472286 antikoerper, daglb antikoerper, DAGLB antikoerper, LOC100286527 antikoerper, LOC100444000 antikoerper, Daglb antikoerper

Hintergrund: DAGLB belongs to the AB hydrolase superfamily.It catalyzes the hydrolysis of diacylglycerol (DAG) to 2-arachidonoyl-glycerol (2-AG), the most abundant endocannabinoid in tissues. This protein is required for axonal growth during development and for retrograde synaptic signaling at mature synapses.

Molekulargewicht: 74 kDa (MW of target protein)