Layilin Antikörper (N-Term)

Produktnummer ABIN636057

Dieses Anti-Layilin-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Layilin in WB. Geeignet für Human.

Kurzübersicht für Layilin Antikörper (N-Term) (ABIN636057)

Target: Layilin (LAYN)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Layilin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Layilin Antikörper

Bindungsspezifität: N-Term

Spezifität: LAYN antibody was raised against the N terminal of LAYN

Aufreinigung: Affinity purified

Immunogen: LAYN antibody was raised using the N terminal of LAYN corresponding to a region with amino acids CYKVIYFHDTSRRLNFEEAKEACRRDGGQLVSIESEDEQKLIEKFIENLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LAYN Blocking Peptide, (ABIN937219), is also available for use as a blocking control in assays to test for specificity of this LAYN antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAYN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Layilin

Target: Layilin (LAYN)

Andere Bezeichnung: LAYN

Hintergrund: LAYN contains 1 C-type lectin domain. It is the receptor for hyaluronate.

Molekulargewicht: 42 kDa (MW of target protein)