GDE1 Antikörper (N-Term)

Produktnummer ABIN636050

Der Kaninchen Polyklonal anti-GDE1 Antikörper wird verwendet zum Nachweis von GDE1 in Proben von Human, Ratte, Maus und Hund. Er wurde validiert für WB und IHC.

Kurzübersicht für GDE1 Antikörper (N-Term) (ABIN636050)

Target: GDE1 (Glycerophosphodiester Phosphodiesterase 1 (GDE1))

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GDE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-GDE1 Antikörper

Bindungsspezifität: N-Term

Spezifität: GDE1 antibody was raised against the N terminal Of Gde1

Aufreinigung: Affinity purified

Immunogen: GDE1 antibody was raised using the N terminal Of Gde1 corresponding to a region with amino acids LRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQAAKN

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GDE1 Blocking Peptide, (ABIN5613744), is also available for use as a blocking control in assays to test for specificity of this GDE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GDE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GDE1

Target: GDE1 (Glycerophosphodiester Phosphodiesterase 1 (GDE1))

Andere Bezeichnung: GDE1

Hintergrund: GDE1 has glycerophosphoinositol phosphodiesterase activity. It has little or no activity towards glycerophosphocholine. GDE1 activity can be modulated by G-protein signaling pathways.

Molekulargewicht: 38 kDa (MW of target protein)