TM4SF4 Antikörper (N-Term)

Produktnummer ABIN636043

Produktdetails anti-TM4SF4 Antikörper

Target: TM4SF4 (Transmembrane 4 Superfamily Member 4 (TM4SF4))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TM4SF4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TM4 SF4 antibody was raised against the N terminal of TM4 F4

Aufreinigung: Affinity purified

Immunogen: TM4 SF4 antibody was raised using the N terminal of TM4 F4 corresponding to a region with amino acids CTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TM4SF4 Blocking Peptide, catalog no. 33R-1822, is also available for use as a blocking control in assays to test for specificity of this TM4SF4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TM0 F4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TM4SF4

Target: TM4SF4 (Transmembrane 4 Superfamily Member 4 (TM4SF4))

Andere Bezeichnung: TM4SF4 (TM4SF4 Produkte)

Synonyme: ILTMP antikoerper, il-TMP antikoerper, Lrtm4 antikoerper, Iltmp antikoerper, transmembrane 4 L six family member 4 antikoerper, transmembrane 4 superfamily member 4 antikoerper, TM4SF4 antikoerper, Tm4sf4 antikoerper

Hintergrund: TM4SF4 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This protein is a cell surface glycoprotein that can regulate cell proliferation.

Molekulargewicht: 21 kDa (MW of target protein)