Receptor Accessory Protein 1 Antikörper (C-Term)

Produktnummer ABIN636040

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Receptor Accessory Protein 1 in WB. Er zeigt eine Reaktivität gegenüber Human und Ratte.

Kurzübersicht für Receptor Accessory Protein 1 Antikörper (C-Term) (ABIN636040)

Target: Receptor Accessory Protein 1 (REEP1)

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Receptor Accessory Protein 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Receptor Accessory Protein 1 Antikörper

Bindungsspezifität: C-Term

Spezifität: REEP1 antibody was raised against the C terminal of REEP1

Aufreinigung: Affinity purified

Immunogen: REEP1 antibody was raised using the C terminal of REEP1 corresponding to a region with amino acids ERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

REEP1 Blocking Peptide, catalog no. 33R-2704, is also available for use as a blocking control in assays to test for specificity of this REEP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of REEP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Receptor Accessory Protein 1

Target: Receptor Accessory Protein 1 (REEP1)

Andere Bezeichnung: REEP1

Hintergrund: REEP1 belongs to the DP1 family and may enhance the cell surface expression of odorant receptors.

Molekulargewicht: 22 kDa (MW of target protein)