RDH10 Antikörper

Produktnummer ABIN636035

Der Kaninchen Polyklonal anti-RDH10 Antikörper wird verwendet zum Nachweis von RDH10 in Proben von Human, Ratte und Maus. Er wurde validiert für WB.

Kurzübersicht für RDH10 Antikörper (ABIN636035)

Target: RDH10 (Retinol Dehydrogenase 10 (All-Trans) (RDH10))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RDH10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RDH10 Antikörper

Aufreinigung: Affinity purified

Immunogen: RDH10 antibody was raised using a synthetic peptide corresponding to a region with amino acids QSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RDH10 Blocking Peptide, (ABIN5615818), is also available for use as a blocking control in assays to test for specificity of this RDH10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDH10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RDH10

Target: RDH10 (Retinol Dehydrogenase 10 (All-Trans) (RDH10))

Andere Bezeichnung: RDH10

Hintergrund: RDH10 is a retinol dehydrogenase with a clear preference for NADP. RDH10 converts all-trans-retinol to all-trans-retinal. RDH10 has no detectable activity towards 11-cis-retinol, 9-cis-retinol and 13-cis-retinol.RDH10 generates all-trans retinal from all-trans retinol and may plan an important role in the photic visual cycle.

Molekulargewicht: 38 kDa (MW of target protein)