B3GNT7 Antikörper (N-Term)

Produktnummer ABIN636032

Produktdetails anti-B3GNT7 Antikörper

Target: B3GNT7 (beta-1,3-N-Acetylglucosaminyltransferase 7 (B3GNT7))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser B3GNT7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: B3 GNT7 antibody was raised against the N terminal of B3 NT7

Aufreinigung: Affinity purified

Immunogen: B3 GNT7 antibody was raised using the N terminal of B3 NT7 corresponding to a region with amino acids QFLFYRHCRYFPMLLNHPEKCRGDVYLLVVVKSVITQHDRREAIRQTWGR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

B3GNT7 Blocking Peptide, catalog no. 33R-7546, is also available for use as a blocking control in assays to test for specificity of this B3GNT7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 NT7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu B3GNT7

Target: B3GNT7 (beta-1,3-N-Acetylglucosaminyltransferase 7 (B3GNT7))

Andere Bezeichnung: B3GNT7 (B3GNT7 Produkte)

Synonyme: cb543 antikoerper, ssp1 antikoerper, beta3GnT7 antikoerper, C330001H22Rik antikoerper, beta-3GnT7 antikoerper, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 antikoerper, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 S homeolog antikoerper, b3gnt7 antikoerper, b3gnt7.S antikoerper, B3GNT7 antikoerper, B3gnt7 antikoerper

Hintergrund: B3GNT7 belongs to the glycosyltransferase 31 family. It may be involved in keratane sulfate biosynthesis. B3GNT7 transfers N-acetylgalactosamine on to keratan sulfate-related glycans. It may play a role in preventing cells from migrating out of the original tissues and invading surrounding tissues.

Molekulargewicht: 46 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process