PON3 Antikörper (Middle Region)

Produktnummer ABIN636029

Der Kaninchen Polyklonal anti-PON3 Antikörper wird verwendet zum Nachweis von PON3 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für PON3 Antikörper (Middle Region) (ABIN636029)

Target: PON3 (Paraoxonase 3 (PON3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PON3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PON3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PON3 antibody was raised against the middle region of PON3

Aufreinigung: Affinity purified

Immunogen: PON3 antibody was raised using the middle region of PON3 corresponding to a region with amino acids PMKLLNYNPEDPPGSEVLRIQNVLSEKPRVSTVYANNGSVLQGTSVASVY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PON3 Blocking Peptide, (ABIN5615472), is also available for use as a blocking control in assays to test for specificity of this PON3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PON3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PON3

Target: PON3 (Paraoxonase 3 (PON3))

Andere Bezeichnung: PON3

Hintergrund: This gene is a member of the paraoxonase family and lies in a cluster on chromosome 7 with the other two family members. The encoded protein is secreted into the bloodstream and associates with high-density lipoprotein (HDL).

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process