UXS1 Antikörper (Middle Region)
-
- Target Alle UXS1 Antikörper anzeigen
- UXS1 (UDP-Glucuronate Decarboxylase 1 (UXS1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UXS1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- UXS1 antibody was raised against the middle region of UXS1
- Aufreinigung
- Affinity purified
- Immunogen
- UXS1 antibody was raised using the middle region of UXS1 corresponding to a region with amino acids LMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRH
- Top Product
- Discover our top product UXS1 Primärantikörper
-
anti-UDP-Glucuronate Decarboxylase 1 (UXS1) antibody
UXS1 Reaktivität: Human, Maus, Ratte ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-UDP-Glucuronate Decarboxylase 1 (UXS1) (AA 201-420) antibodyUXS1 Reaktivität: Human ELISA, WB Wirt: Kaninchen Polyclonal unconjugated
anti-UDP-Glucuronate Decarboxylase 1 (UXS1) (AA 337-366), (C-Term) antibodyUXS1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB33038 unconjugated
anti-UDP-Glucuronate Decarboxylase 1 (UXS1) (C-Term) antibodyUXS1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Fledermaus, Affe, Schwein, Huhn, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UXS1 Blocking Peptide, catalog no. 33R-5205, is also available for use as a blocking control in assays to test for specificity of this UXS1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UXS1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UXS1 (UDP-Glucuronate Decarboxylase 1 (UXS1))
- Andere Bezeichnung
- UXS1 (UXS1 Produkte)
- Synonyme
- SDR6E1 antikoerper, UGD antikoerper, 1600025I13Rik antikoerper, AI451869 antikoerper, AI649125 antikoerper, AW550562 antikoerper, CHUNP6891 antikoerper, fj36b08 antikoerper, wu:fj36b08 antikoerper, zgc:91980 antikoerper, UDP-glucuronate decarboxylase 1 antikoerper, uxs1 antikoerper, UXS1 antikoerper, Ccan_02290 antikoerper, Uxs1 antikoerper
- Hintergrund
- UDP-glucuronate decarboxylase catalyzes the formation of UDP-xylose from UDP-glucuronate. UDP-xylose is then used to initiate glycosaminoglycan biosynthesis on the core protein of proteoglycans.
- Molekulargewicht
- 47 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-
