UXS1 Antikörper (Middle Region)

Produktnummer ABIN636016

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch UXS1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für UXS1 Antikörper (Middle Region) (ABIN636016)

Target: UXS1 (UDP-Glucuronate Decarboxylase 1 (UXS1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UXS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-UXS1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: UXS1 antibody was raised against the middle region of UXS1

Aufreinigung: Affinity purified

Immunogen: UXS1 antibody was raised using the middle region of UXS1 corresponding to a region with amino acids LMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UXS1 Blocking Peptide, (ABIN5616942), is also available for use as a blocking control in assays to test for specificity of this UXS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UXS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UXS1

Target: UXS1 (UDP-Glucuronate Decarboxylase 1 (UXS1))

Andere Bezeichnung: UXS1

Hintergrund: UDP-glucuronate decarboxylase catalyzes the formation of UDP-xylose from UDP-glucuronate. UDP-xylose is then used to initiate glycosaminoglycan biosynthesis on the core protein of proteoglycans.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process