UXS1 Antikörper (Middle Region)

Produktnummer ABIN636016

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch UXS1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für UXS1 Antikörper (Middle Region) (ABIN636016)

Target: UXS1 (UDP-Glucuronate Decarboxylase 1 (UXS1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UXS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-UXS1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: UXS1 antibody was raised against the middle region of UXS1

Aufreinigung: Affinity purified

Immunogen: UXS1 antibody was raised using the middle region of UXS1 corresponding to a region with amino acids LMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UXS1 Blocking Peptide, (ABIN5616942), is also available for use as a blocking control in assays to test for specificity of this UXS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UXS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UXS1

Target: UXS1 (UDP-Glucuronate Decarboxylase 1 (UXS1))

Andere Bezeichnung: UXS1

Hintergrund: UDP-glucuronate decarboxylase catalyzes the formation of UDP-xylose from UDP-glucuronate. UDP-xylose is then used to initiate glycosaminoglycan biosynthesis on the core protein of proteoglycans.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process