UGT2A3 Antikörper (N-Term)

Produktnummer ABIN636014

Der Kaninchen Polyklonal Anti-UGT2A3-Antikörper wurde für WB validiert. Er ist geeignet, UGT2A3 in Proben von Human zu detektieren.

Kurzübersicht für UGT2A3 Antikörper (N-Term) (ABIN636014)

Target: UGT2A3 (UDP Glucuronosyltransferase 2 Family, Polypeptide A3 (UGT2A3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UGT2A3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-UGT2A3 Antikörper

Bindungsspezifität: N-Term

Spezifität: UGT2 A3 antibody was raised against the N terminal of µgT2 3

Aufreinigung: Affinity purified

Immunogen: UGT2 A3 antibody was raised using the N terminal of µgT2 3 corresponding to a region with amino acids NVKVILEELIVRGHEVTVLTHSKPSLIDYRKPSALKFEVVHMPQDRTEEN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UGT2A3 Blocking Peptide, (ABIN5616902), is also available for use as a blocking control in assays to test for specificity of this µgT2A3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UGT2A3

Target: UGT2A3 (UDP Glucuronosyltransferase 2 Family, Polypeptide A3 (UGT2A3))

Andere Bezeichnung: UGT2A3

Hintergrund: UGT2A3 is a single-pass type I membrane proteinPotential. It belongs to the UDP-glycosyltransferase family. UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.

Molekulargewicht: 60 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis