SRD5A3 Antikörper (N-Term)

Produktnummer ABIN636011

Der Kaninchen Polyklonal Anti-SRD5A3 Antikörper wurde für WB validiert. Er ist geeignet, SRD5A3 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für SRD5A3 Antikörper (N-Term) (ABIN636011)

Target: SRD5A3 (Steroid 5 alpha-Reductase 3 (SRD5A3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SRD5A3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SRD5A3 Antikörper

Bindungsspezifität: N-Term

Spezifität: SRD5 A3 antibody was raised against the N terminal of SRD5 3

Aufreinigung: Affinity purified

Immunogen: SRD5 A3 antibody was raised using the N terminal of SRD5 3 corresponding to a region with amino acids GLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFDVPKRYFSHFYIISVLWN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SRD5A3 Blocking Peptide, (ABIN938794), is also available for use as a blocking control in assays to test for specificity of this SRD5A3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRD0 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SRD5A3

Target: SRD5A3 (Steroid 5 alpha-Reductase 3 (SRD5A3))

Andere Bezeichnung: SRD5A3

Hintergrund: SRD5A3 belongs to the steroid 5-alpha reductase family and converts testosterone (T) into 5-alpha-dihydrotestosterone (DHT).

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis