GALNT14 Antikörper
-
- Target Alle GALNT14 Antikörper anzeigen
- GALNT14 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 14 (GalNAc-T14) (GALNT14))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GALNT14 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- GALNT14 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEIVPCSRVGHVFRKKHPYVFPDGNANTYIKNTKRTAEVWMDEYKQYYYA
- Top Product
- Discover our top product GALNT14 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GALNT14 Blocking Peptide, catalog no. 33R-4908, is also available for use as a blocking control in assays to test for specificity of this GALNT14 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNT14 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GALNT14 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 14 (GalNAc-T14) (GALNT14))
- Andere Bezeichnung
- GALNT14 (GALNT14 Produkte)
- Synonyme
- 0610033M06Rik antikoerper, si:ch211-147c1.1 antikoerper, GALNT15 antikoerper, GalNac-T10 antikoerper, GalNac-T14 antikoerper, polypeptide N-acetylgalactosaminyltransferase 14 antikoerper, UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 14 (GalNAc-T14) antikoerper, GALNT14 antikoerper, galnt14 antikoerper, Galnt14 antikoerper
- Hintergrund
- GALNT14 (EC 2.4.1.41) belongs to a large subfamily of glycosyltransferases residing in the Golgi apparatus. GALNT enzymes catalyze the first step in the O-glycosylation of mammalian proteins by transferring N-acetyl-D-galactosamine (GalNAc) to peptide substrates.
- Molekulargewicht
- 64 kDa (MW of target protein)
-