CASD1 Antikörper (N-Term)

Produktnummer ABIN636009

Produktdetails anti-CASD1 Antikörper

Target: CASD1 (CAS1 Domain Containing 1 (CASD1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CASD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CASD1 antibody was raised against the N terminal of CASD1

Aufreinigung: Affinity purified

Immunogen: CASD1 antibody was raised using the N terminal of CASD1 corresponding to a region with amino acids MAALAYNLGKREINHYFSVRSAKVLALVAVLLLAACHLASRRYRGNDSCE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CASD1 Blocking Peptide, catalog no. 33R-5598, is also available for use as a blocking control in assays to test for specificity of this CASD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CASD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CASD1

Target: CASD1 (CAS1 Domain Containing 1 (CASD1))

Andere Bezeichnung: CASD1 (CASD1 Produkte)

Synonyme: zgc:136291 antikoerper, si:dkey-104m9.2 antikoerper, C7orf12 antikoerper, NBLA04196 antikoerper, Cas1 antikoerper, Cast1 antikoerper, CAS1 domain containing 1 antikoerper, CAS1 domain-containing protein 1 antikoerper, CASD1 antikoerper, casd1 antikoerper, CpipJ_CPIJ003344 antikoerper, LOC100540591 antikoerper, Casd1 antikoerper

Hintergrund: The function of CASD1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 91 kDa (MW of target protein)