CASD1 Antikörper (N-Term)

Produktnummer ABIN636009

Dieses Anti-CASD1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von CASD1 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für CASD1 Antikörper (N-Term) (ABIN636009)

Target: CASD1 (CAS1 Domain Containing 1 (CASD1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CASD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CASD1 Antikörper

Bindungsspezifität: N-Term

Spezifität: CASD1 antibody was raised against the N terminal of CASD1

Aufreinigung: Affinity purified

Immunogen: CASD1 antibody was raised using the N terminal of CASD1 corresponding to a region with amino acids MAALAYNLGKREINHYFSVRSAKVLALVAVLLLAACHLASRRYRGNDSCE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CASD1 Blocking Peptide, (ABIN5612629), is also available for use as a blocking control in assays to test for specificity of this CASD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CASD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CASD1

Target: CASD1 (CAS1 Domain Containing 1 (CASD1))

Andere Bezeichnung: CASD1

Hintergrund: The function of CASD1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 91 kDa (MW of target protein)