Emc7 Antikörper (Middle Region)

Produktnummer ABIN636001

Produktdetails anti-Emc7 Antikörper

Target: Emc7 (ER membrane protein complex subunit 7 (Emc7))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Emc7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C15 ORF24 antibody was raised against the middle region of C15 rf24

Aufreinigung: Affinity purified

Immunogen: C15 ORF24 antibody was raised using the middle region of C15 rf24 corresponding to a region with amino acids VDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C15ORF24 Blocking Peptide, catalog no. 33R-9464, is also available for use as a blocking control in assays to test for specificity of this C15ORF24 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF24 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Emc7

Target: Emc7 (ER membrane protein complex subunit 7 (Emc7))

Andere Bezeichnung: C15ORF24 (Emc7 Produkte)

Synonyme: si:ch211-150c22.3 antikoerper, c15orf24 antikoerper, C10H15orf24 antikoerper, C15orf24 antikoerper, C11orf3 antikoerper, ORF1-FL1 antikoerper, 2900064A13Rik antikoerper, AI451465 antikoerper, ORF3 antikoerper, c11orf3 antikoerper, ER membrane protein complex subunit 7 antikoerper, emc7 antikoerper, EMC7 antikoerper, Emc7 antikoerper

Hintergrund: The function of C15orf24 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 26 kDa (MW of target protein)