FLJ20674 (N-Term) Antikörper

Produktnummer ABIN636000

Dieses Anti--Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für FLJ20674 (N-Term) Antikörper (ABIN636000)

Target: FLJ20674

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails

Bindungsspezifität: N-Term

Spezifität: FLJ20674 antibody was raised against the N terminal of FLJ20674

Aufreinigung: Affinity purified

Immunogen: FLJ20674 antibody was raised using the N terminal of FLJ20674 corresponding to a region with amino acids LNVTQWFQVWLQVASGPYQIEVHIVATGTLPNGTLYAARGSQVDFSCNSS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FLJ20674 Blocking Peptide, (ABIN5613608), is also available for use as a blocking control in assays to test for specificity of this FLJ20674 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ20674 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: FLJ20674

Hintergrund: The function of FLJ20674 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 59 kDa (MW of target protein)