TMEM51 Antikörper (N-Term)

Produktnummer ABIN635996

Der Kaninchen Polyklonal Anti-TMEM51-Antikörper wurde für WB validiert. Er ist geeignet, TMEM51 in Proben von Human zu detektieren.

Kurzübersicht für TMEM51 Antikörper (N-Term) (ABIN635996)

Target: TMEM51 (Transmembrane Protein 51 (TMEM51))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM51 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMEM51 Antikörper

Bindungsspezifität: N-Term

Spezifität: TMEM51 antibody was raised against the N terminal of TMEM51

Aufreinigung: Affinity purified

Immunogen: TMEM51 antibody was raised using the N terminal of TMEM51 corresponding to a region with amino acids GFSAAEKPTAQGSNKTEVGGGILKSKTFSVAYVLVGAGVMLLLLSICLSI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM51 Blocking Peptide, (ABIN938650), is also available for use as a blocking control in assays to test for specificity of this TMEM51 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM51 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM51

Target: TMEM51 (Transmembrane Protein 51 (TMEM51))

Andere Bezeichnung: TMEM51

Hintergrund: TMEM51 is a multi-pass membrane protein. The function of the TMEM51 protein remains unknown.

Molekulargewicht: 28 kDa (MW of target protein)