TMCO3 Antikörper (N-Term)

Produktnummer ABIN635995

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch TMCO3 in WB. Er zeigt eine Reaktivität gegenüber Human und Ratte.

Kurzübersicht für TMCO3 Antikörper (N-Term) (ABIN635995)

Target: TMCO3 (Transmembrane and Coiled-Coil Domains 3 (TMCO3))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMCO3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMCO3 Antikörper

Bindungsspezifität: N-Term

Spezifität: TMCO3 antibody was raised against the N terminal of TMCO3

Aufreinigung: Affinity purified

Immunogen: TMCO3 antibody was raised using the N terminal of TMCO3 corresponding to a region with amino acids KTAIGAVEKDVGLSDEEKLFQVHTFEIFQKELNESENSVFQAVYGLQRAL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMCO3 Blocking Peptide, catalog no. 33R-4672, is also available for use as a blocking control in assays to test for specificity of this TMCO3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMCO3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMCO3

Target: TMCO3 (Transmembrane and Coiled-Coil Domains 3 (TMCO3))

Andere Bezeichnung: TMCO3

Hintergrund: TMCO3 belongs to the monovalent cation:proton antiporter 2 (CPA2) transporter family. It is a multi-pass membrane protein. TMCO3 is a probable Na(+)/H(+) antiporter.

Molekulargewicht: 75 kDa (MW of target protein)

Pathways: Proton Transport