ARMCX3 Antikörper (Middle Region)

Produktnummer ABIN635988

Produktdetails anti-ARMCX3 Antikörper

Target: ARMCX3 (Armadillo Repeat Containing, X-Linked 3 (ARMCX3))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ARMCX3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ARMCX3 antibody was raised against the middle region of ARMCX3

Aufreinigung: Affinity purified

Immunogen: ARMCX3 antibody was raised using the middle region of ARMCX3 corresponding to a region with amino acids LFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKE

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARMCX3 Blocking Peptide, catalog no. 33R-4948, is also available for use as a blocking control in assays to test for specificity of this ARMCX3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARMCX3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ARMCX3

Target: ARMCX3 (Armadillo Repeat Containing, X-Linked 3 (ARMCX3))

Andere Bezeichnung: ARMCX3 (ARMCX3 Produkte)

Synonyme: ALEX3 antikoerper, dJ545K15.2 antikoerper, 1200004E24Rik antikoerper, AI450003 antikoerper, ARMCX3 antikoerper, DKFZp459E2029 antikoerper, armadillo repeat containing, X-linked 3 antikoerper, ARMCX3 antikoerper, Armcx3 antikoerper

Hintergrund: ARMCX3 is a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis.

Molekulargewicht: 42 kDa (MW of target protein)