ARMCX3 Antikörper (Middle Region)
-
- Target Alle ARMCX3 Antikörper anzeigen
- ARMCX3 (Armadillo Repeat Containing, X-Linked 3 (ARMCX3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ARMCX3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ARMCX3 antibody was raised against the middle region of ARMCX3
- Aufreinigung
- Affinity purified
- Immunogen
- ARMCX3 antibody was raised using the middle region of ARMCX3 corresponding to a region with amino acids LFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKE
- Top Product
- Discover our top product ARMCX3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ARMCX3 Blocking Peptide, catalog no. 33R-4948, is also available for use as a blocking control in assays to test for specificity of this ARMCX3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARMCX3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ARMCX3 (Armadillo Repeat Containing, X-Linked 3 (ARMCX3))
- Andere Bezeichnung
- ARMCX3 (ARMCX3 Produkte)
- Hintergrund
- ARMCX3 is a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis.
- Molekulargewicht
- 42 kDa (MW of target protein)
-