ARMCX3 Antikörper (Middle Region)

Produktnummer ABIN635988

Dieser Anti-ARMCX3-Antikörper ist ein Kaninchen-Polyklonal-Antikörper zum Nachweis von ARMCX3 in WB. Geeignet für Human.

Kurzübersicht für ARMCX3 Antikörper (Middle Region) (ABIN635988)

Target: ARMCX3 (Armadillo Repeat Containing, X-Linked 3 (ARMCX3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ARMCX3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ARMCX3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ARMCX3 antibody was raised against the middle region of ARMCX3

Aufreinigung: Affinity purified

Immunogen: ARMCX3 antibody was raised using the middle region of ARMCX3 corresponding to a region with amino acids LFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKE

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARMCX3 Blocking Peptide, (ABIN940334), is also available for use as a blocking control in assays to test for specificity of this ARMCX3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARMCX3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ARMCX3

Target: ARMCX3 (Armadillo Repeat Containing, X-Linked 3 (ARMCX3))

Andere Bezeichnung: ARMCX3

Hintergrund: ARMCX3 is a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis.

Molekulargewicht: 42 kDa (MW of target protein)