TMEM9 Antikörper (C-Term)

Produktnummer ABIN635985

Dieses Anti-TMEM9-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von TMEM9 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für TMEM9 Antikörper (C-Term) (ABIN635985)

Target: TMEM9 (Transmembrane Protein 9 (TMEM9))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMEM9 Antikörper

Bindungsspezifität: C-Term

Spezifität: TMEM9 antibody was raised against the C terminal of TMEM9

Aufreinigung: Affinity purified

Immunogen: TMEM9 antibody was raised using the C terminal of TMEM9 corresponding to a region with amino acids DARSMAAAAASLGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM9 Blocking Peptide, (ABIN937249), is also available for use as a blocking control in assays to test for specificity of this TMEM9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM9

Target: TMEM9 (Transmembrane Protein 9 (TMEM9))

Andere Bezeichnung: TMEM9

Hintergrund: TMEM9 belongs to the TMEM9 family. It may be involved in intracellular transport.

Molekulargewicht: 20 kDa (MW of target protein)