SDF4 Antikörper (Middle Region)

Produktnummer ABIN635983

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SDF4 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für SDF4 Antikörper (Middle Region) (ABIN635983)

Target: SDF4 (Stromal Cell Derived Factor 4 (SDF4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SDF4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SDF4 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SDF4 antibody was raised against the middle region of SDF4

Aufreinigung: Affinity purified

Immunogen: SDF4 antibody was raised using the middle region of SDF4 corresponding to a region with amino acids KTHFRAVDPDGDGHVSWDEYKVKFLASKGHSEKEVADAIRLNEELKVDEE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SDF4 Blocking Peptide, (ABIN940063), is also available for use as a blocking control in assays to test for specificity of this SDF4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDF4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SDF4

Target: SDF4 (Stromal Cell Derived Factor 4 (SDF4))

Andere Bezeichnung: SDF4

Hintergrund: SDF4 may regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment.

Molekulargewicht: 39 kDa (MW of target protein)