Prolipoprotein Diacylglyceryl Transferase Antikörper (N-Term)

Produktnummer ABIN635979

Dieser Anti-Prolipoprotein Diacylglyceryl Transferase Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von Prolipoprotein Diacylglyceryl Transferase in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für Prolipoprotein Diacylglyceryl Transferase Antikörper (N-Term) (ABIN635979)

Target: Prolipoprotein Diacylglyceryl Transferase (IGT)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Prolipoprotein Diacylglyceryl Transferase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Prolipoprotein Diacylglyceryl Transferase Antikörper

Bindungsspezifität: N-Term

Spezifität: PIGT antibody was raised against the N terminal of PIGT

Aufreinigung: Affinity purified

Immunogen: PIGT antibody was raised using the N terminal of PIGT corresponding to a region with amino acids PLPSGDVAATFQFRTRWDSELQREGVSHYRLFPKALGQLISKYSLRELHL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PIGT Blocking Peptide, (ABIN5615372), is also available for use as a blocking control in assays to test for specificity of this PIGT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Prolipoprotein Diacylglyceryl Transferase

Target: Prolipoprotein Diacylglyceryl Transferase (IGT)

Andere Bezeichnung: IGT

Hintergrund: PIGT is a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This protein is an essential component of the multisubunit enzyme, GPI transamidase. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins.

Molekulargewicht: 64 kDa (MW of target protein)