DHRS7B Antikörper

Produktnummer ABIN635978

Der Kaninchen Polyklonal anti-DHRS7B Antikörper wird verwendet zum Nachweis von DHRS7B in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für DHRS7B Antikörper (ABIN635978)

Target: DHRS7B (Dehydrogenase/reductase (SDR Family) Member 7B (DHRS7B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DHRS7B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DHRS7B Antikörper

Aufreinigung: Affinity purified

Immunogen: DHRS7 B antibody was raised using a synthetic peptide corresponding to a region with amino acids QAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTTA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DHRS7B Blocking Peptide, (ABIN5613195), is also available for use as a blocking control in assays to test for specificity of this DHRS7B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHRS0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DHRS7B

Target: DHRS7B (Dehydrogenase/reductase (SDR Family) Member 7B (DHRS7B))

Andere Bezeichnung: DHRS7B

Hintergrund: This gene is located within the Smith-Magenis syndrome region on chromosome 17. It encodes a protein of unknown function.

Molekulargewicht: 35 kDa (MW of target protein)