Nurim Antikörper
-
- Target Alle Nurim (NRM) Antikörper anzeigen
- Nurim (NRM) (Nurim (Nuclear Envelope Membrane Protein) (NRM))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Nurim Antikörper ist unkonjugiert
- Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Nurim antibody was raised using a synthetic peptide corresponding to a region with amino acids MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGW
- Top Product
- Discover our top product NRM Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Nurim Blocking Peptide, catalog no. 33R-5708, is also available for use as a blocking control in assays to test for specificity of this Nurim antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRM antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Nurim (NRM) (Nurim (Nuclear Envelope Membrane Protein) (NRM))
- Andere Bezeichnung
- Nurim (NRM Produkte)
- Synonyme
- NRM29 antikoerper, 2610307M02Rik antikoerper, AI429796 antikoerper, si:dkey-263h23.2 antikoerper, nurim antikoerper, nurim (nuclear envelope membrane protein) antikoerper, nurim L homeolog antikoerper, NRM antikoerper, Nrm antikoerper, nrm.L antikoerper, nrm antikoerper
- Hintergrund
- The function of Nurim protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 29 kDa (MW of target protein)
-