Nurim Antikörper

Produktnummer ABIN635972

Der Kaninchen Polyklonal Anti-Nurim-Antikörper wurde für WB validiert. Er ist geeignet, Nurim in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für Nurim Antikörper (ABIN635972)

Target: Nurim (NRM) (Nurim (Nuclear Envelope Membrane Protein) (NRM))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Nurim Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Nurim Antikörper

Aufreinigung: Affinity purified

Immunogen: Nurim antibody was raised using a synthetic peptide corresponding to a region with amino acids MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Nurim Blocking Peptide, (ABIN5615089), is also available for use as a blocking control in assays to test for specificity of this Nurim antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRM antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Nurim

Target: Nurim (NRM) (Nurim (Nuclear Envelope Membrane Protein) (NRM))

Andere Bezeichnung: Nurim

Hintergrund: The function of Nurim protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 29 kDa (MW of target protein)