NOX1 Antikörper (C-Term)

Produktnummer ABIN635971

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch NOX1 in WB. Er zeigt eine Reaktivität gegenüber Human und Hund.

Kurzübersicht für NOX1 Antikörper (C-Term) (ABIN635971)

Target: NOX1 (NADPH Oxidase 1 (NOX1))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NOX1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NOX1 Antikörper

Bindungsspezifität: C-Term

Spezifität: NOX1 antibody was raised against the C terminal of NOX1

Aufreinigung: Affinity purified

Immunogen: NOX1 antibody was raised using the C terminal of NOX1 corresponding to a region with amino acids STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NOX1 Blocking Peptide, (ABIN5615034), is also available for use as a blocking control in assays to test for specificity of this NOX1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOX1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NOX1

Target: NOX1 (NADPH Oxidase 1 (NOX1))

Andere Bezeichnung: NOX1

Hintergrund: Voltage-gated proton (hydrogen) channels play an important role in cellular defense against acidic stress. They are unique among ion channels with respect to their extremely high selectivity, marked temperature dependence, and unitary conductance, which is 3 orders of magnitude lower than that of most other ion channels. NOX1 is a homolog of the catalytic subunit of the superoxide-generating NADPH oxidase of phagocytes, gp91phox.

Molekulargewicht: 65 kDa (MW of target protein)

Pathways: Regulation of Systemic Arterial Blood Pressure by Hormones, Proton Transport