TMEM115 Antikörper (N-Term)

Produktnummer ABIN635970

Dieses Anti-TMEM115-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von TMEM115 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für TMEM115 Antikörper (N-Term) (ABIN635970)

Target: TMEM115 (Transmembrane Protein 115 (TMEM115))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM115 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMEM115 Antikörper

Bindungsspezifität: N-Term

Spezifität: TMEM115 antibody was raised against the N terminal of TMEM115

Aufreinigung: Affinity purified

Immunogen: TMEM115 antibody was raised using the N terminal of TMEM115 corresponding to a region with amino acids LLSFAVDTGCLAVTPGYLFPPNFWIWTLATHGLMEQHVWDVAISLTTVVV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM115 Blocking Peptide, (ABIN5616658), is also available for use as a blocking control in assays to test for specificity of this TMEM115 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM115 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM115

Target: TMEM115 (Transmembrane Protein 115 (TMEM115))

Andere Bezeichnung: TMEM115

Hintergrund: The specific function of TMEM115 is not yet known.

Molekulargewicht: 38 kDa (MW of target protein)