ST3GAL2 Antikörper (C-Term)

Produktnummer ABIN635969

Der Kaninchen Polyklonal Anti-ST3GAL2-Antikörper wurde für WB validiert. Er ist geeignet, ST3GAL2 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für ST3GAL2 Antikörper (C-Term) (ABIN635969)

Target: ST3GAL2 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 2 (ST3GAL2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ST3GAL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ST3GAL2 Antikörper

Bindungsspezifität: C-Term

Spezifität: ST3 GAL2 antibody was raised against the C terminal of ST3 AL2

Aufreinigung: Affinity purified

Immunogen: ST3 GAL2 antibody was raised using the C terminal of ST3 AL2 corresponding to a region with amino acids ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ST3GAL2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this ST3GAL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 AL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ST3GAL2

Target: ST3GAL2 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 2 (ST3GAL2))

Andere Bezeichnung: ST3GAL2

Hintergrund: ST3GAL2 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein is normally found in the Golgi but can be proteolytically processed to a soluble form. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4A.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process