TMED1 Antikörper (Middle Region)

Produktnummer ABIN635968

Produktdetails anti-TMED1 Antikörper

Target: TMED1 (Transmembrane Emp24 Protein Transport Domain Containing 1 (TMED1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMED1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMED1 antibody was raised against the middle region of TMED1

Aufreinigung: Affinity purified

Immunogen: TMED1 antibody was raised using the middle region of TMED1 corresponding to a region with amino acids FTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMED1 Blocking Peptide, catalog no. 33R-3095, is also available for use as a blocking control in assays to test for specificity of this TMED1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMED1

Target: TMED1 (Transmembrane Emp24 Protein Transport Domain Containing 1 (TMED1))

Andere Bezeichnung: TMED1 (TMED1 Produkte)

Synonyme: Il1rl1l antikoerper, Ly84l antikoerper, St2l antikoerper, IL1RL1LG antikoerper, Tp24 antikoerper, tmed1 antikoerper, zgc:92038 antikoerper, zgc:158680 antikoerper, transmembrane p24 trafficking protein 1 antikoerper, transmembrane p24 trafficking protein 1a antikoerper, transmembrane p24 trafficking protein 1b antikoerper, Tmed1 antikoerper, TMED1 antikoerper, tmed1a antikoerper, tmed1b antikoerper

Hintergrund: TMED1 was identified by its interaction with interleukin 1 receptor-like 1 (IL1RL1). This protein lacks any similarity to other interleukin 1 ligands. The functional significance of its interaction with IL1RL1 is not known.

Molekulargewicht: 23 kDa (MW of target protein)