TMED1 Antikörper (Middle Region)

Produktnummer ABIN635968

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch TMED1 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für TMED1 Antikörper (Middle Region) (ABIN635968)

Target: TMED1 (Transmembrane Emp24 Protein Transport Domain Containing 1 (TMED1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMED1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMED1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: TMED1 antibody was raised against the middle region of TMED1

Aufreinigung: Affinity purified

Immunogen: TMED1 antibody was raised using the middle region of TMED1 corresponding to a region with amino acids FTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMED1 Blocking Peptide, (ABIN938481), is also available for use as a blocking control in assays to test for specificity of this TMED1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMED1

Target: TMED1 (Transmembrane Emp24 Protein Transport Domain Containing 1 (TMED1))

Andere Bezeichnung: TMED1

Hintergrund: TMED1 was identified by its interaction with interleukin 1 receptor-like 1 (IL1RL1). This protein lacks any similarity to other interleukin 1 ligands. The functional significance of its interaction with IL1RL1 is not known.

Molekulargewicht: 23 kDa (MW of target protein)