ERLIN1 Antikörper (N-Term)

Produktnummer ABIN635966

Der Kaninchen Polyklonal Anti-ERLIN1-Antikörper wurde für WB validiert. Er ist geeignet, ERLIN1 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für ERLIN1 Antikörper (N-Term) (ABIN635966)

Target: ERLIN1 (ER Lipid Raft Associated 1 (ERLIN1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ERLIN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ERLIN1 Antikörper

Bindungsspezifität: N-Term

Spezifität: ERLIN1 antibody was raised against the N terminal of ERLIN1

Aufreinigung: Affinity purified

Immunogen: ERLIN1 antibody was raised using the N terminal of ERLIN1 corresponding to a region with amino acids KNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFNKIH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ERLIN1 Blocking Peptide, (ABIN939963), is also available for use as a blocking control in assays to test for specificity of this ERLIN1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERLIN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ERLIN1

Target: ERLIN1 (ER Lipid Raft Associated 1 (ERLIN1))

Andere Bezeichnung: ERLIN1

Hintergrund: Erlin-1 belongs to the band 7/mec-2 family. Erlin-1 and erlin-2 are novel members of the prohibitin family of proteins that define lipid-raft-like domains of the ER.

Molekulargewicht: 39 kDa (MW of target protein)