PI3 Antikörper

Produktnummer ABIN635953

Produktdetails anti-PI3 Antikörper

Target: PI3 (Peptidase Inhibitor 3, Skin-Derived (PI3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PI3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PI3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PI3 Blocking Peptide, catalog no. 33R-7825, is also available for use as a blocking control in assays to test for specificity of this PI3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PI3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PI3

Target: PI3 (Peptidase Inhibitor 3, Skin-Derived (PI3))

Andere Bezeichnung: PI3 (PI3 Produkte)

Synonyme: ESI antikoerper, SKALP antikoerper, WAP3 antikoerper, WFDC14 antikoerper, cementoin antikoerper, trappin-2 antikoerper, TRAPPIN-2 antikoerper, elafin antikoerper, peptidase inhibitor 3 antikoerper, peptidase inhibitor 3, skin-derived (SKALP) antikoerper, PI3 antikoerper

Hintergrund: PI3 is an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria. PI3 contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. PI3 belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines.

Molekulargewicht: 6 kDa (MW of target protein)