SLC39A12 Antikörper
-
- Target Alle SLC39A12 Antikörper anzeigen
- SLC39A12 (Solute Carrier Family 39 (Zinc Transporter), Member 12 (SLC39A12))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC39A12 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC39 A12 antibody was raised using a synthetic peptide corresponding to a region with amino acids MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVL
- Top Product
- Discover our top product SLC39A12 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC39A12 Blocking Peptide, catalog no. 33R-5811, is also available for use as a blocking control in assays to test for specificity of this SLC39A12 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 12 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC39A12 (Solute Carrier Family 39 (Zinc Transporter), Member 12 (SLC39A12))
- Andere Bezeichnung
- SLC39A12 (SLC39A12 Produkte)
- Synonyme
- LZT-Hs8 antikoerper, ZIP-12 antikoerper, bA570F3.1 antikoerper, AW046938 antikoerper, Gm731 antikoerper, solute carrier family 39 member 12 antikoerper, solute carrier family 39 (zinc transporter), member 12 antikoerper, SLC39A12 antikoerper, Slc39a12 antikoerper, slc39a12 antikoerper
- Hintergrund
- SLC39A12 may act as a zinc-influx transporter and also may be partly involved in the outbreak of schizophrenia.
- Molekulargewicht
- 73 kDa (MW of target protein)
-