SLC13A2 Antikörper

Produktnummer ABIN635937

Dieses Anti-SLC13A2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von SLC13A2 in WB. Geeignet für Human.

Kurzübersicht für SLC13A2 Antikörper (ABIN635937)

Target: SLC13A2 (Solute Carrier Family 13 Member 2 (SLC13A2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC13A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC13A2 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLC13 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PNAKGESMVSDGTVAIFIGIIMFIIPSKFPGLTQDPENPGKLKAPLGLLD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC13A2 Blocking Peptide, (ABIN5616179), is also available for use as a blocking control in assays to test for specificity of this SLC13A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC13A2

Target: SLC13A2 (Solute Carrier Family 13 Member 2 (SLC13A2))

Andere Bezeichnung: SLC13A2

Hintergrund: SLC13A2 belongs to the SLC13A transporter family, NADC subfamily. It is a multi-pass membrane protein. SLC13A2 cotransports of sodium ions and dicarboxylates such as succinate and citrate.

Molekulargewicht: 64 kDa (MW of target protein)