UGCG Antikörper (N-Term)

Produktnummer ABIN635932

Produktdetails anti-UGCG Antikörper

Target: UGCG (UDP-Glucose Ceramide Glucosyltransferase (UGCG))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UGCG Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UGCG antibody was raised against the N terminal of µgCG

Aufreinigung: Affinity purified

Immunogen: UGCG antibody was raised using the N terminal of µgCG corresponding to a region with amino acids LHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UGCG Blocking Peptide, catalog no. 33R-5018, is also available for use as a blocking control in assays to test for specificity of this µgCG antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgCG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UGCG

Target: UGCG (UDP-Glucose Ceramide Glucosyltransferase (UGCG))

Andere Bezeichnung: UGCG (UGCG Produkte)

Synonyme: GCS antikoerper, GLCT1 antikoerper, XLCGT antikoerper, gcs antikoerper, glct1 antikoerper, ugcga antikoerper, xlcgt antikoerper, cb539 antikoerper, sb:cb539 antikoerper, zgc:112506 antikoerper, ugcg antikoerper, ugcgb antikoerper, AU043821 antikoerper, C80537 antikoerper, Epcs21 antikoerper, GlcT-1 antikoerper, Ugcgl antikoerper, UDP-glucose ceramide glucosyltransferase antikoerper, UDP-glucose ceramide glucosyltransferase L homeolog antikoerper, UDP-glucose ceramide glucosyltransferase S homeolog antikoerper, UGCG antikoerper, ugcg.L antikoerper, Ugcg antikoerper, ugcg antikoerper, ugcg.S antikoerper

Hintergrund: Glycosphingolipids (GSLs) are a group of membrane components that contain lipid and sugar moieties. They are present in essentially all animal cells and are believed to have important roles in various cellular processes.

Molekulargewicht: 45 kDa (MW of target protein)