Receptor Accessory Protein 4 Antikörper (N-Term)

Produktnummer ABIN635929

Produktdetails anti-Receptor Accessory Protein 4 Antikörper

Target: Receptor Accessory Protein 4 (REEP4)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Receptor Accessory Protein 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: REEP4 antibody was raised against the N terminal of REEP4

Aufreinigung: Affinity purified

Immunogen: REEP4 antibody was raised using the N terminal of REEP4 corresponding to a region with amino acids EIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

REEP4 Blocking Peptide, catalog no. 33R-2476, is also available for use as a blocking control in assays to test for specificity of this REEP4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of REEP4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Receptor Accessory Protein 4

Target: Receptor Accessory Protein 4 (REEP4)

Andere Bezeichnung: REEP4 (REEP4 Produkte)

Synonyme: C8orf20 antikoerper, 2700029E10Rik antikoerper, RGD1306561 antikoerper, receptor accessory protein 4 antikoerper, REEP4 antikoerper, Reep4 antikoerper

Hintergrund: REEP4 belongs to the DP1 family. It may enhance the cell surface expression of odorant receptors.

Molekulargewicht: 29 kDa (MW of target protein)