Receptor Accessory Protein 4 Antikörper (N-Term)

Produktnummer ABIN635929

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Receptor Accessory Protein 4 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für Receptor Accessory Protein 4 Antikörper (N-Term) (ABIN635929)

Target: Receptor Accessory Protein 4 (REEP4)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Receptor Accessory Protein 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Receptor Accessory Protein 4 Antikörper

Bindungsspezifität: N-Term

Spezifität: REEP4 antibody was raised against the N terminal of REEP4

Aufreinigung: Affinity purified

Immunogen: REEP4 antibody was raised using the N terminal of REEP4 corresponding to a region with amino acids EIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

REEP4 Blocking Peptide, (ABIN937862), is also available for use as a blocking control in assays to test for specificity of this REEP4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of REEP4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Receptor Accessory Protein 4

Target: Receptor Accessory Protein 4 (REEP4)

Andere Bezeichnung: REEP4

Hintergrund: REEP4 belongs to the DP1 family. It may enhance the cell surface expression of odorant receptors.

Molekulargewicht: 29 kDa (MW of target protein)