DNAJB11 Antikörper

Produktnummer ABIN635926

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch DNAJB11 in WB. Er zeigt eine Reaktivität gegenüber Human und Hund.

Kurzübersicht für DNAJB11 Antikörper (ABIN635926)

Target: DNAJB11 (DnaJ (Hsp40) Homolog, Subfamily B, Member 11 (DNAJB11))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DNAJB11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DNAJB11 Antikörper

Aufreinigung: Affinity purified

Immunogen: DNAJB11 antibody was raised using a synthetic peptide corresponding to a region with amino acids FDNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQKVYNGLQGY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DNAJB11 Blocking Peptide, (ABIN938254), is also available for use as a blocking control in assays to test for specificity of this DNAJB11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJB11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DNAJB11

Target: DNAJB11 (DnaJ (Hsp40) Homolog, Subfamily B, Member 11 (DNAJB11))

Andere Bezeichnung: DNAJB11

Hintergrund: DNAJB11 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus, a glycine/phenylalanine (G/F)-rich region, and a C-terminal cysteine-rich region.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling