ALG6 Antikörper
-
- Target Alle ALG6 Antikörper anzeigen
- ALG6 (Asparagine-Linked Glycosylation 6, alpha-1,3-Glucosyltransferase Homolog (ALG6))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ALG6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ALG6 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRTTVLIADLLI
- Top Product
- Discover our top product ALG6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ALG6 Blocking Peptide, catalog no. 33R-7210, is also available for use as a blocking control in assays to test for specificity of this ALG6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALG6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALG6 (Asparagine-Linked Glycosylation 6, alpha-1,3-Glucosyltransferase Homolog (ALG6))
- Andere Bezeichnung
- ALG6 (ALG6 Produkte)
- Hintergrund
- ALG6 is a member of the ALG6/ALG8 glucosyltransferase family. It catalyzes the addition of the first glucose residue to the growing lipid-linked oligosaccharide precursor of N-linked glycosylation. Mutations in this gene encoding ALG6 are associated with congenital disorders of glycosylation type Ic.
- Molekulargewicht
- 58 kDa (MW of target protein)
-