ALG6 Antikörper

Produktnummer ABIN635917

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch ALG6 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für ALG6 Antikörper (ABIN635917)

Target: ALG6 (Asparagine-Linked Glycosylation 6, alpha-1,3-Glucosyltransferase Homolog (ALG6))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALG6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ALG6 Antikörper

Aufreinigung: Affinity purified

Immunogen: ALG6 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRTTVLIADLLI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALG6 Blocking Peptide, (ABIN5612020), is also available for use as a blocking control in assays to test for specificity of this ALG6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALG6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALG6

Target: ALG6 (Asparagine-Linked Glycosylation 6, alpha-1,3-Glucosyltransferase Homolog (ALG6))

Andere Bezeichnung: ALG6

Hintergrund: ALG6 is a member of the ALG6/ALG8 glucosyltransferase family. It catalyzes the addition of the first glucose residue to the growing lipid-linked oligosaccharide precursor of N-linked glycosylation. Mutations in this gene encoding ALG6 are associated with congenital disorders of glycosylation type Ic.

Molekulargewicht: 58 kDa (MW of target protein)